Recombinant Proteins
- (285)
- (11)
- (65,867)
- (1)
- (2)
- (970)
- (1)
- (23,540)
- (5)
- (1)
- (1)
- (67)
- (216)
- (4,420)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,448)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (157)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (22,591)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,799)
- (253)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (105)
- (1)
- (3,750)
- (1,407)
- (3)
- (4)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (138)
- (48)
- (6)
- (17)
- (2)
- (1)
- (10)
- (4)
- (81)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,522)
- (2)
- (1)
- (160)
- (18)
- (48)
- (3)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (208)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,708)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,758)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (27,095)
- (235)
- (1)
- (3)
- (2)
- (1)
- (2)
- (1)
- (89)
- (559)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,303)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (29,092)
- (5)
- (22)
- (8)
- (4)
- (1,291)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (8)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (233)
- (9)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,574)
- (1)
- (48)
- (15)
- (1)
- (2)
- (45,208)
- (5,648)
- (245)
- (168)
- (56)
- (3,361)
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (3)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (43,090)
- (1)
- (11)
Filtered Search Results
R&D Systems™ Recombinant Rat Pentraxin 2/SAP Protein
Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.
| Purity or Quality Grade | 95%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
|---|---|
| Conjugate | Unconjugated |
| Molecular Weight (g/mol) | 25 kDa |
| Gene ID (Entrez) | 29339 |
| Quantity | 50 μg |
| Structural Form | Noncovalently-linked homopentamer |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution. |
| Source | Mouse myeloma cell line,NS0-derived rat Pentraxin 2/SAP protein Gln21-Ser228 with a C-terminal 10-His tag |
| Recombinant | Recombinant |
| Name | Pentraxin 2/SAP |
Novus Biologicals Zika Virus (Unpurified) Native Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
| Formulation | PBS pH7.4 |
|---|---|
| Storage Requirements | Store at 4C short term. Aliquot and store at -80C long term. Avoid freeze-thaw cycles. |
| Protein | Zika Virus (Unpurified) |
R&D Systems™ Recombinant Human Caspase-10 (Mch 4) Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity
R&D Systems™ Recombinant Canine TNF RI/TNFRSF1A Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
| Purity or Quality Grade | 95%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
|---|---|
| Conjugate | Unconjugated |
| Molecular Weight (g/mol) | 21.6 kDa |
| Quantity | 25 μg |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution. |
| Source | E. coli-derived canine TNF RI/TNFRSF1A protein Ile22-Thr211,with an N-terminal Met |
| Recombinant | Recombinant |
| Name | TNF RI/TNFRSF1A |
R&D Systems™ Recombinant Human IL-39 Fc Chimera Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
Novus Biologicals™ Recombinant Human Dnmt3L His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | DNA (cytosine-5-)-methyltransferase 3-like, DNA (cytosine-5)-methyltransferase 3-like, human cytosine-5-methyltransferase 3-like protein, 10cytosine-5-methyltransferase 3-like protein, MGC1090 |
| Common Name | Dnmt3L |
| Molecular Weight (g/mol) | TMW: 46.2kDa |
| Gene ID (Entrez) | 29947 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.25mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Human Integrin alpha 9 beta 1 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ PSMG3 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | PSMG3 |
| Molecular Weight (g/mol) | 15.2kDa |
| Gene ID (Entrez) | 84262 |
| Formulation | Liquid. In 20mM Tris-HCl Buffer (pH 8.0) containing 10% Glycerol |
| Immunogen | PSMG3, 1-122aa. MGSSHHHHHHSSGLVPRGSHMEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
Novus Biologicals™ Recombinant Human DNTTIP1 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ THEM2 Recombinant Protein Antigen
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
Novus Biologicals™ Recombinant Human Melan-A/MART-1 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
R&D Systems™ Recombinant Feline TNF-alpha Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.